PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 352aa    MW: 39934.7 Da    PI: 7.6203
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588680.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W++++++ g+ R++k+c++rw +yl
   XP_013588680.1 14 RGLWSPEEDEKLINYINTYGHGCWSSVPKHAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding48.42.1e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
   XP_013588680.1  67 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.788961IPR017930Myb domain
SuperFamilySSF466898.78E-3011108IPR009057Homeodomain-like
SMARTSM007175.8E-151363IPR001005SANT/Myb domain
PfamPF002495.6E-171461IPR001005SANT/Myb domain
CDDcd001672.05E-131761No hitNo description
PROSITE profilePS5129425.20962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2565116IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.2E-1467110IPR001005SANT/Myb domain
CDDcd001672.62E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIN TYGHGCWSSV PKHAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SPQEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLMSHH  120
YHHHHGHHHH HTSSMASLLT NLPYHNVFNG TVCDDEGSRF MSSIIANTNP NFITPNHLPL  180
PSHVMTPLMF PTSREGDVKY LTTTNTNRSH QDNNLSTNLD IFSATPFINN HHHHHDNDPQ  240
WPSLPDLPAS TISTFHDSLQ DYDDGDKLNV FVTPHNDSGD PRNFPLVSTK LLCGQVLEGK  300
AISQDHCLLL PTTYDLQMHG DYRRVDSYIN HMIIPSSSSS SSPISCGQYV IT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195880.0AY519588.1 Arabidopsis thaliana MYB transcription factor (At3g13890) mRNA, complete cds.
GenBankDQ4466610.0DQ446661.1 Arabidopsis thaliana clone pENTR221-At3g13890 myb family transcription factor (At3g13890) mRNA, complete cds.
GenBankDQ6530830.0DQ653083.1 Arabidopsis thaliana clone 0000019124_0000013170 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588680.10.0PREDICTED: transcription factor MYB26-like
SwissprotQ9SPG31e-173MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A0D3ADU00.0A0A0D3ADU0_BRAOL; Uncharacterized protein
STRINGBra021515.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128031930
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-170myb domain protein 26